DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG9593

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster


Alignment Length:333 Identity:92/333 - (27%)
Similarity:142/333 - (42%) Gaps:75/333 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   545 ESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGS 609
            |....|..|.||..|.......:.:.||  .|.:..|:.|......:.|....:||         
  Fly   100 ERLNQEERISTNLLELKEWSTKVCQEPS--PSQTLPKELTEEKDEPKVDFYQPAKS--------- 153

Human   610 EADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQ-SGIFNIKLPGSSKI----FSVYCDQETSL 669
                                 ||.::    ..|.: .|::...:|..:::    :..||...|..
  Fly   154 ---------------------DCHEL----DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDG 193

Human   670 GGWLLIQQR---MDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGS-VLRVELED 730
            ..|.:||.|   .|...||||:|.:|:.|||:|:    .:||.||::.|.:..|.. .||:||::
  Fly   194 PAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLS----RDFWFGNEFAHKILYRDDHELRIELQE 254

Human   731 WAGNEAYAEYH-FRVGSEAEGYALQVS-SYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDR--- 790
            ......:|||. |.:.||:..|.|.|: .:.|:..|||           ..||.|.|||:||   
  Fly   255 AGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDAL-----------EQHNRMDFSTYDRRRN 308

Human   791 DADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRA 855
            .|...:..|.|.||||||::.|...||||.:   |.:  :..||     .::|:::|......::
  Fly   309 HAKSADSTCGEDYGGGWWFDRCTQCNLNGEH---GVH--QRASP-----AIIWMNWRTGTDKPKS 363

Human   856 VRMKIRPL 863
            .||.|||:
  Fly   364 SRMMIRPV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 16/92 (17%)
FReD 630..863 CDD:238040 77/246 (31%)
CG9593NP_650493.2 FReD 150..371 CDD:238040 79/279 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.