DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG5550

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster


Alignment Length:234 Identity:84/234 - (35%)
Similarity:117/234 - (50%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   636 LQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN 700
            |....||.|      |:...|.:..||||...:..|||::|:|:....||.|.|..|:.|||.| 
  Fly    42 LNPKKSGVQ------KIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDL- 99

Human   701 DEGEGEFWLGNDYLHLLTQ-RGSVLRVELEDWAGNEAYAEYH-FRVGSEAEGYAL-QVSSYEGTA 762
               :|.|::|.:.|:.::. :...|.:||.|:||.:.||.|. |.||:....|.: |:.:|.|||
  Fly   100 ---KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161

Human   763 GDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNC----QAANLNGIYYP 823
            ||:|           :.|....|||||||.|....|||..|.|.|||..|    ..:||||.|..
  Fly   162 GDSL-----------SYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLG 215

Human   824 GGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRP 862
            |...||.     ...:|:||..::|..||.:.|.:.:||
  Fly   216 GNHTDPA-----LFGSGIVWGEWKGFTYSYKTVNIMVRP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 1/1 (100%)
FReD 630..863 CDD:238040 84/234 (36%)
CG5550NP_001246376.1 FReD 34..250 CDD:238040 84/234 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.