DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG9500

DIOPT Version :9

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:303 Identity:103/303 - (33%)
Similarity:149/303 - (49%) Gaps:47/303 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   577 SSYSKQFTSSTSYNRGDSTFESKS-----YKMA----DEAGSEADHEGTHSTKRG----HAKSRP 628
            |.||.:...|.|: :.|:...:|.     ||:.    :|..|.|..|....:...    ....|.
  Fly    14 SFYSTEAMDSESF-QNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRY 77

Human   629 VRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYK 693
            ...|    .|:|..  .||:.:::.| .|.|.|.||.|.:..||.::.:|....|||.|:|.:||
  Fly    78 PSQC----PTYPPA--HGIYTVQVLG-LKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYK 135

Human   694 RGFGSLNDEGEGEFWLGNDYLHLLTQ-RGSVLRVELEDWAGNEAYAEY-HFRVGSEAEGYAL-QV 755
            .|||.|    :|:|::|.|.||.:|: :...|.:.|||:.|...||.| ...:.||.:.||: ::
  Fly   136 NGFGQL----DGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKL 196

Human   756 SSYEGTAGDALIEGSVEEGAEYTSHN-NMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNG 819
            ..:.|.|||::|            || |..|||||||.|.|.:||||.|.|.||:.||..:||.|
  Fly   197 GEFTGDAGDSMI------------HNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFG 249

Human   820 IYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRP 862
            ||..|      :...|....|:||.|:|...||.:.::|.:||
  Fly   250 IYVKG------DEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 50..187 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 15/73 (21%)
FReD 630..863 CDD:238040 89/237 (38%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 90/240 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.