DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG6788

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster


Alignment Length:235 Identity:90/235 - (38%)
Similarity:123/235 - (52%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   638 THPSGTQSGIFNIK---LPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSL 699
            |.|...:.||:.:|   ||.    |...|    |..|||.||:|.||:.||:|.|:|||.|||.:
  Fly   152 TCPIDGKGGIYKLKIRELPA----FEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRV 208

Human   700 NDEGEGEFWLGNDYLHLLT-QRGSVLRVELEDWAGNEAYAEY-HFRVGSEAEGYALQ-VSSYEGT 761
                .|||::|.:.:||:| ||...|.::|....|..::|.| :|.:|.|.|.|.|: :..|.||
  Fly   209 ----RGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGT 269

Human   762 AGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGS 826
            |||:|           ..|...:|:|.|:|.|.:..|||....|||||.:|..:.|||.:|..|.
  Fly   270 AGDSL-----------RPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGR 323

Human   827 YDPRNNSPYEIENGVVWVSFRGAD--YSLRAVRMKIRPLV 864
              .||..    .||::|.|:...|  |||..|.|.|||.:
  Fly   324 --SRNGK----TNGILWGSWHNNDWTYSLTFVEMMIRPRI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 90/235 (38%)
FReD 630..863 CDD:238040 89/232 (38%)
CG6788NP_573254.1 FReD 160..356 CDD:238040 87/224 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.