DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG1889

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:246 Identity:88/246 - (35%)
Similarity:120/246 - (48%) Gaps:32/246 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   622 GHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFN 686
            |.|.:.|:...:.:.|.|      |:..|:...:.:.|.|:|||:...|||.::..|.|||.:||
  Fly   116 GGAAAVPITPANCLKQQH------GVVRIRPRSNVEPFFVFCDQKVRNGGWTMVVNRYDGSEDFN 174

Human   687 RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSV-LRVELEDWAGNEAYAEY-HFRVGSEAE 749
            |.|.|||.|||.|..    ||::|.|.||.:|...:. |.|:|::......||.| ||.:|||:|
  Fly   175 RKWADYKIGFGPLTT----EFFIGLDKLHQITSSDNYELLVQLQNRKQELRYALYDHFSIGSESE 235

Human   750 GYALQV-SSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWY-NNC 812
            .|.|.| ..|.|.|.|||           ..|...:|||.||..|:.|:|||....|.:|| .:|
  Fly   236 QYRLNVLGDYHGDAADAL-----------RDHTGKKFSTHDRVNDENEQNCAAQQSGAFWYGGSC 289

Human   813 QAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSF-RGADYSLRAVRMKIRP 862
            ...|      |.|.|........:...|::|..| .|...||:.|||.:||
  Fly   290 NLTN------PFGLYQRLLERDVDGFKGILWRGFLNGPKGSLKIVRMMVRP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 3/15 (20%)
FReD 630..863 CDD:238040 85/238 (36%)
CG1889NP_727376.2 FReD 123..335 CDD:238040 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.