DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG1791

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster


Alignment Length:247 Identity:94/247 - (38%)
Similarity:126/247 - (51%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   636 LQTHPSGT-------QSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYK 693
            |.|.|..|       :.|...|::....:.|...|||:...|||::|..|.|||.:||:.||:||
  Fly   113 LATPPDDTPRNCYDEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYK 177

Human   694 RGFGSLNDEGEGEFWLGNDYLHLLT-QRGSVLRVELEDWAGNEAYAEY-HFRVGSEAEGYALQV- 755
            .|||:||    .||::|.|.||.|| .....|.:.::..:|.|.:|.| ||.:|||:|.|.|.| 
  Fly   178 AGFGALN----SEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVL 238

Human   756 SSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWY-NNCQAANLNG 819
            .:|:|.|||:|         .|  |...:|:|||:|.|...:|||..:.|.||| ..|..:||.|
  Fly   239 GAYKGDAGDSL---------RY--HAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFG 292

Human   820 IYYPGGSYDPRNNSPYEIE----NGVVWVSF-RGADYSLRAVRMKIRPLVTQ 866
            .:          .|.|..|    .|::|.|| .|...||..|||.||||..|
  Fly   293 TF----------QSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLKKQ 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 1/1 (100%)
FReD 630..863 CDD:238040 91/242 (38%)
CG1791NP_572591.1 FReD 119..331 CDD:238040 88/236 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.