DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGA and CG30281

DIOPT Version :10

Sequence 1:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:292 Identity:104/292 - (35%)
Similarity:140/292 - (47%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   589 YNRGDSTFES---------KSYKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSG-- 642
            |.:.:|...|         :|||...|      ..|:|.|                  .:||.  
  Fly    29 YKKAESMVSSLKIRLEELKQSYKEITE------ERGSHET------------------INPSSCL 69

Human   643 ----TQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEG 703
                ..:||..|::||... |.||||...:..||.:||:|.|||.||.|.|::|.:|||.|:   
  Fly    70 AAGINSNGIHVIEVPGLEP-FPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELS--- 130

Human   704 EGEFWLGNDYLHLLTQRGSV-LRVELEDWAGNEAYAEYH-FRVGSEAEGYALQV-SSYEGTAGDA 765
             |||::|.:.||.||..... |.|.:||:.|....|.|. |.:|:.:..|||.| ..|.|.|||:
  Fly   131 -GEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDS 194

Human   766 LIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPR 830
            |         .|  |..|.|||||.  |.....||.:|.|.|||:.||.:||||.|..||.::|:
  Fly   195 L---------RY--HKGMPFSTFDH--DDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPK 246

Human   831 NNSPYEIENGVVWVSFRGADYSLRAVRMKIRP 862
            .:.     .|:.|:|:||.||..:.|:|.|||
  Fly   247 MSG-----RGITWMSWRGYDYGYKFVQMMIRP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 49..191 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 10/57 (18%)
FReD 630..863 CDD:238040 94/242 (39%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 94/234 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.