DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt8b and Wnt6

DIOPT Version :9

Sequence 1:NP_035850.2 Gene:Wnt8b / 22423 MGIID:109485 Length:368 Species:Mus musculus
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:361 Identity:121/361 - (33%)
Similarity:159/361 - (44%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 GAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFD 127
            |...|..||::||...||||  ..|:.|....|...:|||.||:||::|||.|.:|:.|::|...
  Fly    63 GINLGFRECEFQFRNRRWNC--TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLV 125

Mouse   128 NCGCDDSRNGQLGGQ-------------------------------------------------- 142
            .|.||.:...:.|||                                                  
  Fly   126 ECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIA 190

Mouse   143 ------------------------------GWLWGGCSDNVGFGEAISKQFVDALETGQ--DARA 175
                                          .|.||||||||.||...|:.|:||.:..:  |...
  Fly   191 PVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT 255

Mouse   176 AMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG 240
            .:..|||.|||.|::..|:..|||||:|||||.:||||::|.||||...|:::|.:|.|| .|:.
  Fly   256 LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV-TLRN 319

Mouse   241 AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCR 305
            .|||.......|   |..:..:||..:||||:|..|...|.|||:||||........|     |.
  Fly   320 DGNSFMPESPHA---RPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDR-----CD 376

Mouse   306 RLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQC 341
            |||  |......|..|..::|.|.|.|||.|.||:|
  Fly   377 RLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt8bNP_035850.2 WNT1 39..350 CDD:128408 121/361 (34%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/361 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.