DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt7b and wntD

DIOPT Version :9

Sequence 1:NP_001157106.1 Gene:Wnt7b / 22422 MGIID:98962 Length:353 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:312 Identity:82/312 - (26%)
Similarity:132/312 - (42%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    65 VIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQ-----ELRVGSREAAFTYAITAAGVAHAVT 124
            :.|:|.:..:|.||..|::.||||.:..    |.|     |....:||..:..||:.|.:.|.:|
  Fly    39 ITGKGLKQALDSCQQSFQWQRWNCPSQD----FVQKNSKPEENSPNREDVYVAAISMAAIVHTLT 99

Mouse   125 AACSQGNLSNCGCD---------REKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA 180
            ..|:.|.::.|||.         .|......|.|.....|..|     |..:||.|.|       
  Fly   100 KDCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGA-----IGHNRRVVGA------- 152

Mouse   181 RRLMNLHNNEAGRKVLEDRMKLECKCH---GVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQV 242
                          :|:..::.||:|.   .|.|.|..:.|...|..|..:...|.:.|:.|:|:
  Fly   153 --------------LLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL 203

Mouse   243 EVVRASRLRQPTFLRIKQLRSYQK-PMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGA- 305
            |...::       |:|    .:|. |::: ||:::.||||||.||.....||:||.|::...|: 
  Fly   204 EGASSN-------LKI----MWQNIPLDS-LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSL 256

Mouse   306 ---DGCDTMC--CGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 352
               ..|..:|  ||....:.......:||||..|...::|:.|.:....::|
  Fly   257 EERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt7bNP_001157106.1 wnt_Wnt7b 36..353 CDD:381724 82/312 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 81/308 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.