DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt7b and Wnt6

DIOPT Version :9

Sequence 1:NP_001157106.1 Gene:Wnt7b / 22422 MGIID:98962 Length:353 Species:Mus musculus
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:427 Identity:142/427 - (33%)
Similarity:196/427 - (45%) Gaps:94/427 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    10 LVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII---VIGEGAQ 71
            |:.|....||.:..:|...|..:.:.|..|::|.|...|..:...||  |.|:.:   :|..|..
  Fly     3 LLMVIAILIFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGIN 65

Mouse    72 MGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCG 136
            :|..||:.|||..||||:.|  :....:.|...|||..|..|||||||.:|||.||:.|.|..|.
  Fly    66 LGFRECEFQFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECS 128

Mouse   137 CDR-------------------------------------------------------------E 140
            ||:                                                             |
  Fly   129 CDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVE 193

Mouse   141 KQGYYNQAEG------------------WKWGGCSADVRYGIDFSRRFVDA--REIKKNARRLMN 185
            .:|..|:..|                  |:|||||.:|.:|:..||.|:||  |:.:.:...|:.
  Fly   194 HRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVK 258

Mouse   186 LHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRL 250
            .|||.|||..:.|.|:|||||||:|||||.||||..:|.||||...|:::|::|.:|.:......
  Fly   259 FHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS 323

Mouse   251 RQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGR 315
            ..|.....:....||      ||:.:.||::|..::.||::|||||.||.||.|:|.||.:||.|
  Fly   324 FMPESPHARPANKYQ------LVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNR 382

Mouse   316 GYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 352
            |:......:...|.|.|.|||.|.|..|.|...|.||
  Fly   383 GHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt7bNP_001157106.1 wnt_Wnt7b 36..353 CDD:381724 136/401 (34%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 130/387 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.