DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt7a and wntD

DIOPT Version :9

Sequence 1:NP_033553.2 Gene:Wnt7a / 22421 MGIID:98961 Length:349 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:310 Identity:84/310 - (27%)
Similarity:128/310 - (41%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    61 VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGK-ELKVGSREAAFTYAIIAAGVAHAITAACT 124
            :.|:|.:..||.||..|:..||||.:........| |....:||..:..||..|.:.|.:|..|.
  Fly    39 ITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCA 103

Mouse   125 QGNLSDCGCDKEKQG------------QYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNAR 177
            .|.::.|||.:....            ||.:..|   .|..|     ||                
  Fly   104 NGVIAGCGCTENALNVPCAHEPTKALEQYEKHFG---SGSGA-----IG---------------- 144

Mouse   178 TLMNLHNNEAGRKILEENMKLECKCH---GVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVE 239
                 ||......:|:.:::.||:|.   .|.|.|..:.|...|..|..:...|...|::|:.:|
  Fly   145 -----HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE 204

Mouse   240 PVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNK----TAPQ 300
              .||.|.:..:..|        |:|: ||:::.||||||.|......||:||.|:|    :..:
  Fly   205 --GASSNLKIMWQNI--------PLDS-LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEE 258

Mouse   301 ASGCDLMCCGRGYNTH-QYARV-WQCNCKFHWCCYVKCNTCSERTEMYTC 348
            ...|..:|...||... |:.|. .:||||..|...::|:.|.:....|:|
  Fly   259 RLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt7aNP_033553.2 Wnt_Wnt7a 32..349 CDD:381723 84/310 (27%)
Disordered linker. /evidence=ECO:0000250|UniProtKB:O00755 238..266 6/27 (22%)
wntDNP_650272.1 wnt 41..308 CDD:302926 83/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.