DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt7a and Wnt5

DIOPT Version :9

Sequence 1:NP_033553.2 Gene:Wnt7a / 22421 MGIID:98961 Length:349 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:466 Identity:136/466 - (29%)
Similarity:185/466 - (39%) Gaps:163/466 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 CNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSR 102
            |....||:..|:..|......:..|..|::..:.||||||:|.|||||...:.||||....:.:.
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAP 612

Mouse   103 EAAFTYAIIAAGVAHAITAACTQGNLSDCGCDK-EKQGQYHRDEGWKWGGCSADIRYGIGFAKVF 166
            |.||.:|:.||.|...|..||..|.|:.|.|.: .:..|.|.|  ||||||..::.:...||..|
  Fly   613 EMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDD--WKWGGCGDNLEFAYKFATDF 675

Mouse   167 VDARE---------------------------------IKQN----------------------- 175
            :|:||                                 ||:|                       
  Fly   676 IDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAE 740

Mouse   176 ----------------------------------------------------------------- 175
                                                                             
  Fly   741 NSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQ 805

Mouse   176 --------------------------------ARTLMNLHNNEAGRKILEENMKLECKCHGVSGS 208
                                            ||:|||||||||||:.:.:..::.|||||||||
  Fly   806 RAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGS 870

Mouse   209 CTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEK 273
            |:..|||..|...||:|..|::||..|..|:     .|||.. |:| |.|.::.|...||:|:::
  Fly   871 CSLITCWQQLSSIREIGDYLREKYEGATKVK-----INKRGR-LQI-KDLQFKVPTAHDLIYLDE 928

Mouse   274 SPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNT 338
            ||::|.........||.||.|:|.:.....|.::||||||||.......:|||||||||.|||..
  Fly   929 SPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEV 993

Mouse   339 CSERTEMYTCK 349
            |::..|.:|||
  Fly   994 CTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt7aNP_033553.2 Wnt_Wnt7a 32..349 CDD:381723 134/464 (29%)
Disordered linker. /evidence=ECO:0000250|UniProtKB:O00755 238..266 9/27 (33%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 132/458 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.