DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt10

DIOPT Version :9

Sequence 1:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:453 Identity:144/453 - (31%)
Similarity:197/453 - (43%) Gaps:106/453 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 PVPSR-----LGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAE 63
            |..||     |.::::|.|...     |..|.|   |..:.||....|...|.|||....:|.|.
  Fly    43 PATSRHCNLHLIVMIILACCTR-----WLYGLP---DGRATCRSVPGLTKDQVELCYKASDVTAA 99

Mouse    64 LARGARLGVRECQFQFRFRRWNCSS--------HSKAFGRVLQQDIRETAFVFAITAAGASHAVT 120
            ...|..:.:||||.||::.||||||        |:.:   :|::..||:||.|||:|||.:|:|.
  Fly   100 ALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASS---LLKKGYRESAFAFAISAAGVAHSVA 161

Mouse   121 QACSMGELLQCGCQAPRGRAPPR------------------PSGLLGTPGPPGPTGSPDASAAWE 167
            :|||.|.|:.|||.....|....                  .:..:.||...........::.|:
  Fly   162 RACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWK 226

Mouse   168 WGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCAL 232
            ||||..::|||.|.|:||:|.:.|  .|||::.:.||||.|||:||.::....|||||:||||.|
  Fly   227 WGGCSHNMDFGVEYSKLFLDCREK--AGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQL 289

Mouse   233 RTCWQKLPPFREVGARLLERFHGASRV----MGTNDGKALLPAVRTLKPPG-------------- 279
            :|||:..|.|..||..|..:|..|..|    :|..:...:|...|..|..|              
  Fly   290 KTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDST 354

Mouse   280 --------------------------------------------RADLLYAADSPDFCAPNRRTG 300
                                                        ...|.|...||:||..:....
  Fly   355 DASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGAD 419

Mouse   301 SPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLC 363
            ..||.||.||.:.....||..|||||||.|...:..|.|.|:|.|||.|:|..|.|.:.:|:|
  Fly   420 IQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 135/418 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 2/39 (5%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 124/388 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.