DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt5

DIOPT Version :9

Sequence 1:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:490 Identity:128/490 - (26%)
Similarity:188/490 - (38%) Gaps:175/490 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 AVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCS--SH 89
            |....:.::|.: |..|..|:..|.:.|.....|:..::||||..::||||||:.||||||  :.
  Fly   536 AYSETIDLNPNN-CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTND 599

Mouse    90 SKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPP 154
            ...||.:......|.||:.|:.||..:..:.:||..|:|..|.|.  ||..|.:           
  Fly   600 ETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCS--RGSRPKQ----------- 651

Mouse   155 GPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQH----------KRGRGDI------------ 197
                   ....|:||||||:::|..:.:..|:|::.          ||.|.:|            
  Fly   652 -------LHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNA 709

Mouse   198 ----------------------------------------------------------------- 197
                                                                             
  Fly   710 FNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEM 774

Mouse   198 ----------------------------------------------------------------R 198
                                                                            |
  Fly   775 IKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKAR 839

Mouse   199 ALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTN 263
            :|:.||||||||.||....|..|||||:||||:|.||||:|...||:|..|.|::.||::|....
  Fly   840 SLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINK 904

Mouse   264 DGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGH 328
            .|:..:..:: .|.|...||:|..:|||:|..:.....|||.||.|:.::..|..|.:||||||:
  Fly   905 RGRLQIKDLQ-FKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGY 968

Mouse   329 RQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLC 363
            ..:::.:.|.|.|:|||||.|:|..|....|...|
  Fly   969 NTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTC 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 127/483 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 1/21 (5%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 124/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.