DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FES and PIN3

DIOPT Version :9

Sequence 1:NP_001996.1 Gene:FES / 2242 HGNCID:3657 Length:822 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:33/144 - (22%)
Similarity:50/144 - (34%) Gaps:34/144 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    10 PQGHGVLQQMQEAELRLLEGMR-KWM------------AQRVKSDREYAGLLHHMSLQDSGGQSR 61
            ||..|.|......:::|||.:. :|.            |..||.           :...|.|.|.
Yeast    67 PQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKP-----------AFSGSNGPSN 120

Human    62 AISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQE 126
            ...|....:|...:|.:|....|...:|      ..|....:...:.:||.::....|.||.||:
Yeast   121 LPPPPQYKAQELQQIPTQNSAASSYQQQ------PFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQ 179

Human   127 LTKTHSQDIEKLKS 140
            ...:||.    |||
Yeast   180 HQSSHSH----LKS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FESNP_001996.1 Important for interaction with membranes containing phosphoinositides 1..300 33/144 (23%)
F-BAR_Fes 7..239 CDD:153369 33/144 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..421
SH2_Fps_family 453..537 CDD:198224
Pkinase_Tyr 561..814 CDD:285015
PTKc_Fes 564..815 CDD:270667
PIN3NP_015480.1 SH3 58..110 CDD:418401 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.