DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FES and skb5

DIOPT Version :9

Sequence 1:NP_001996.1 Gene:FES / 2242 HGNCID:3657 Length:822 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:22/107 - (20%)
Similarity:34/107 - (31%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   256 QPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVA 320
            :.|.:|....|.|...||......|...::||.|         .....::...|:....|..::.
pombe     4 ETEEDYLVVGRDYLYPPDHELHYGFHARVIEEEE---------ERFVDDTFDETIEGSDDSESID 59

Human   321 TEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVLQE 362
            ...||...|           |.|:|||.....:|.....|.:
pombe    60 DTEVFYDAE-----------ESESTHPSASFNVLADAVALYD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FESNP_001996.1 Important for interaction with membranes containing phosphoinositides 1..300 10/43 (23%)
F-BAR_Fes 7..239 CDD:153369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..421
SH2_Fps_family 453..537 CDD:198224
Pkinase_Tyr 561..814 CDD:285015
PTKc_Fes 564..815 CDD:270667
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.