DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5b and Wnt5

DIOPT Version :9

Sequence 1:XP_036021918.1 Gene:Wnt5b / 22419 MGIID:98959 Length:394 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:457 Identity:157/457 - (34%)
Similarity:225/457 - (49%) Gaps:145/457 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    83 CSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSR 147
            |....|||..|:|.|..:...|..|..||:..|:|||.||:.|||||||.::.:|||.:..:.:.
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAP 612

Mouse   148 ETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVD 212
            |.||.:|::||.|.:.|:||||:|:|::|.|||.:|||.|..||.|||||||:|:.|:||.:|:|
  Fly   613 EMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFID 677

Mouse   213 AREREKN---------------------------------------------------------- 219
            :||:|.|                                                          
  Fly   678 SREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENS 742

Mouse   220 -----------------------------------------------FAKGSEE----------- 226
                                                           |.||.::           
  Fly   743 HILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRA 807

Mouse   227 -----------------------------QGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCS 262
                                         :.|:||||.|||||||||.|.|.:.|||||||||||
  Fly   808 AADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCS 872

Mouse   263 LKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNE 327
            |.|||.||:..|::||.|:|||:.|..::|.::|:|::.:.:|..||..||:|:|.|||:|..:.
  Fly   873 LITCWQQLSSIREIGDYLREKYEGATKVKINKRGRLQIKDLQFKVPTAHDLIYLDESPDWCRNSY 937

Mouse   328 TTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYV 392
            .....||.||:|:|.|.|::.|.::||||||:....:..|||:|:|||||.|:|:.||:|::::.
  Fly   938 ALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHT 1002

Mouse   393 CK 394
            ||
  Fly  1003 CK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5bXP_036021918.1 Wnt_Wnt5b 83..394 CDD:381722 155/455 (34%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 153/449 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003382
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.