DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5a and wntD

DIOPT Version :9

Sequence 1:XP_006518986.1 Gene:Wnt5a / 22418 MGIID:98958 Length:393 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:298 Identity:80/298 - (26%)
Similarity:131/298 - (43%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   107 GEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIG-SRETAFTYAVSAAGVVNAMSRACREG 170
            |:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:|:.:::.|..|
  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105

Mouse   171 ELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARER-ERIHAKGSYESARILMNLH 234
            .::.|||:..|  .::|       |          |.|...|.|: |:....||....      |
  Fly   106 VIAGCGCTENA--LNVP-------C----------AHEPTKALEQYEKHFGSGSGAIG------H 145

Mouse   235 NNEAGRRTVYNLADVACKCH---GVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMR-LNSRG 295
            |.......:....:..|:|.   .|.|.|..:.|...|..|..:...|.:.||.|..:. .:|..
  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL 210

Mouse   296 KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEG----MDGCELMCCGRG 356
            |::..|...:|     ||::..||:||.|:.:....||:||.|:|...|    ...|:.:|...|
  Fly   211 KIMWQNIPLDS-----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270

Mouse   357 YD-QFKTVQTE-RCHCKFHWCCYVKCKKCTEIVDQFVC 392
            |. :.:.|:|| ||:||..|...::|..|.::..|:.|
  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5aXP_006518986.1 Wnt_Wnt5a 82..393 CDD:381721 80/298 (27%)
wntDNP_650272.1 wnt 41..308 CDD:302926 79/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.