DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt5

DIOPT Version :9

Sequence 1:NP_033549.1 Gene:Wnt4 / 22417 MGIID:98957 Length:351 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:463 Identity:138/463 - (29%)
Similarity:199/463 - (42%) Gaps:160/463 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    43 CEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTR 107
            |....||...|.:.|.::..||.::.|||:.||:|||:||:||||||||.:...|||.:.:....
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAP 612

Mouse   108 EAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQ----GFQWSGCSDNIAYGVAFSQS 168
            |.||::|:::|.|...:.|||..|:|..|.|.|   |..|:    .::|.||.||:.:...|:..
  Fly   613 EMAFIHALAAATVTSFIARACRDGQLASCSCSR---GSRPKQLHDDWKWGGCGDNLEFAYKFATD 674

Mouse   169 FVDVRE----------------------------------------------------------- 174
            |:|.||                                                           
  Fly   675 FIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEA 739

Mouse   175 ----------------------------------------------------------------- 174
                                                                             
  Fly   740 ENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKN 804

Mouse   175 --------------------------RSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSG 213
                                      ||.....:|:|||||||||||:|::...|:.||||||||
  Fly   805 QRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSG 869

Mouse   214 SCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPD 278
            ||.:.|||:.:...|::|..|:||::|||:|:..:.|   .|..::.|||..|..||:||:.|||
  Fly   870 SCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRG---RLQIKDLQFKVPTAHDLIYLDESPD 931

Mouse   279 FCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQR 343
            :|.........||.||.|:|.|..::.|.:||||||::|..:.:.|||.|:|||||.|||..|.:
  Fly   932 WCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTK 996

Mouse   344 LVEMHTCR 351
            ::|.|||:
  Fly   997 VLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_033549.1 Wnt_Wnt4 43..351 CDD:381710 137/461 (30%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 135/455 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842351
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22529
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.