DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3a and wntD

DIOPT Version :9

Sequence 1:NP_033548.1 Gene:Wnt3a / 22416 MGIID:98956 Length:352 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:297 Identity:76/297 - (25%)
Similarity:121/297 - (40%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    68 EGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGS 132
            :|:|..:..||..|:.:||||.:.........|..:...||..:|.||:.|.:...:|:.||.|.
  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGV 106

Mouse   133 AAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIAS 197
            .|.|||:......|        |:.:       ..:..:..|....:.|....||.......:..
  Fly   107 IAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAIGHNRRVVGALLQR 156

Mouse   198 HMHLKCKCH---GLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPR 259
            .:..:|:|.   .:.|.|:.:.|......|..|...|...||.|.::        .|....|  :
  Fly   157 SLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--------EGASSNL--K 211

Mouse   260 YTYFKVPTERDLVYYEASPNFCEPNPETGSF-GTRDRTCNVSSHG-ID---GCDLLC--CG---R 314
            ..:..:|.: .||:.:.|||:|| ...||.: |||.|.|:....| ::   .|..||  ||   |
  Fly   212 IMWQNIPLD-SLVFMQDSPNYCE-RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVR 274

Mouse   315 GHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTC 351
            ..:.|||||   |:|...|...:.|..|.::...::|
  Fly   275 SQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3aNP_033548.1 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 76/297 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 75/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.