DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3a and Wnt5

DIOPT Version :9

Sequence 1:NP_033548.1 Gene:Wnt3a / 22416 MGIID:98956 Length:352 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:479 Identity:139/479 - (29%)
Similarity:200/479 - (41%) Gaps:169/479 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 YS-SLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSL 95
            || ::...|..|.|..||...|.:.|..:..:||:::.|.:|.|||||.||:.|||||:| :|..
  Fly   537 YSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCST-TNDE 600

Mouse    96 AIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSP----GEGWKWGGCS 156
            .:|||:...|..|.||:||:|:|.|...:.|:|.:|..|.|.||   :||.    .:.||||||.
  Fly   601 TVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCS---RGSRPKQLHDDWKWGGCG 662

Mouse   157 EDIEFGGMVSREFADARENRPD------------------------------------------- 178
            :::||....:.:|.|:||...:                                           
  Fly   663 DNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTS 727

Mouse   179 ----------------------------------------------------------------- 178
                                                                             
  Fly   728 LVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFK 792

Mouse   179 ---------------------------------------------ARSAMNRHNNEAGRQAIASH 198
                                                         |||.||.|||||||:|:...
  Fly   793 GEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKK 857

Mouse   199 MHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYF 263
            ..:.|||||:||||.:.|||......|.|||:|::||:.|:::.:.|    ||   .|:.:...|
  Fly   858 ARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINK----RG---RLQIKDLQF 915

Mouse   264 KVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCH 328
            ||||..||:|.:.||::|..:......||..|.|:.:|.|::.|.:||||||:|.:.....|:|:
  Fly   916 KVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCN 980

Mouse   329 CVFHWCCYVSCQECTRVYDVHTCK 352
            |.|||||.|.|:.||:|.:.||||
  Fly   981 CKFHWCCQVKCEVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3aNP_033548.1 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 135/469 (29%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 131/460 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.