DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3 and wntD

DIOPT Version :9

Sequence 1:NP_033547.1 Gene:Wnt3 / 22415 MGIID:98955 Length:355 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:337 Identity:88/337 - (26%)
Similarity:134/337 - (39%) Gaps:70/337 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 QYTSLASQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSL 98
            |||...: ||....|.|                    :|:|..:..||..|:.:||||.:.|...
  Fly    26 QYTQFQA-PLSWEDITG--------------------KGLKQALDSCQQSFQWQRWNCPSQDFVQ 69

Mouse    99 AIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDAD 163
            ....|..:...||..:|.||:.|.:...:|:.||.|  .|.||               ||:|:| 
  Fly    70 KNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG--VIAGC---------------GCTENA- 116

Mouse   164 FGVLVSREFADARENRP---DARSAMNKHNNEAGRTTILDHMHLKCKCH---GLSGSCEVKTCWW 222
            ..|..:.|...|.|...   .:.|....||.......:...:..:|:|.   .:.|.|:.:.|..
  Fly   117 LNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVA 181

Mouse   223 AQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPN 287
            ....|.||...|...||.|.::        .|....|:..:.  ..|.: .||:.::|||:|| .
  Fly   182 VLKPFEAIAQDLLQMYDDAIQL--------EGASSNLKIMWQ--NIPLD-SLVFMQDSPNYCE-R 234

Mouse   288 PETGSF-GTRDRTCNVTSHG-ID---GCDLLC--CG---RGHNTRTEKRKEKCHCVFHWCCYVSC 342
            ..||.: |||.|.|:....| ::   .|..||  ||   |..:.|||:|   |:|...|...:.|
  Fly   235 DATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERR---CNCKLVWGFRLQC 296

Mouse   343 QECIRIYDVHTC 354
            ..|:::...::|
  Fly   297 DVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3NP_033547.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 85/329 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 81/319 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.