DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt5

DIOPT Version :9

Sequence 1:XP_006505108.1 Gene:Wnt2 / 22413 MGIID:98954 Length:368 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:465 Identity:145/465 - (31%)
Similarity:206/465 - (44%) Gaps:164/465 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 CDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSS 113
            |.:..||.:.|::.|.:|..||.||..|......|||.||:..||||:|.: |.::||.:...::
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTN-DETVFGPMTSLAA 611

Mouse   114 RESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGS-AKDSKGTFDWGGCSDNIDYGIKFAR 177
            .|.||::|:::|.|...|.|||..|:|.||||   .:|| .|.....:.||||.||:::..|||.
  Fly   612 PEMAFIHALAAATVTSFIARACRDGQLASCSC---SRGSRPKQLHDDWKWGGCGDNLEFAYKFAT 673

Mouse   178 AFVDAKER--------------------------------------------------------- 185
            .|:|::|:                                                         
  Fly   674 DFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTE 738

Mouse   186 -----------------------------------------------------KG---------- 187
                                                                 ||          
  Fly   739 AENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRK 803

Mouse   188 --------------------KD------------ARALMNLHNNRAGRKAVKRFLKQECKCHGVS 220
                                ||            ||:|||||||.|||:||.:..:..|||||||
  Fly   804 NQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVS 868

Mouse   221 GSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDY 285
            |||:|.|||..::..|:.||||..||.||.:|.:|:.|. ..:.:.:||.||.:||:|.:.|||:
  Fly   869 GSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGR-LQIKDLQFKVPTAHDLIYLDESPDW 932

Mouse   286 CIRDREAGSL---GTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDC 347
            |   |.:.:|   ||.||||:..|.|::||.::||||||:|.::....:|.|||||||.|:|:.|
  Fly   933 C---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVC 994

Mouse   348 LEALDVHTCK 357
            .:.|:.||||
  Fly   995 TKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2XP_006505108.1 Wnt_Wnt2 44..357 CDD:381719 143/463 (31%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 141/457 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.