DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt9b and Wnt5

DIOPT Version :9

Sequence 1:NP_035849.3 Gene:Wnt9b / 22412 MGIID:1197020 Length:359 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:506 Identity:141/506 - (27%)
Similarity:198/506 - (39%) Gaps:207/506 - (40%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 GLGTA------AAPAQAGAHLKQCDL--------LKLSRRQKQLCRREPGLAETLRDAAHLGLLE 90
            |.|:|      ..|. |.|:.:..||        :.||..||:.|.:...:...:...|...:.|
  Fly   519 GAGSANSHHNDTTPT-ADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQE 582

Mouse    91 CQFQFRQERWNCSLEG-------RTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCD 148
            |||||:..|||||...       .|.|   ...|.||::|::||.:|..:||||..|::..|:| 
  Fly   583 CQFQFKNRRWNCSTTNDETVFGPMTSL---AAPEMAFIHALAAATVTSFIARACRDGQLASCSC- 643

Mouse   149 DSPGLESRQA---WQWGVCGDNLKYSTKFLSNF-------------------------------- 178
             |.|...:|.   |:||.|||||:::.||.::|                                
  Fly   644 -SRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDT 707

Mouse   179 ----LGPKRGS------------------------------------------------------ 185
                :|.||..                                                      
  Fly   708 NAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEE 772

Mouse   186 ------------------------------KDLRARADA-------------------------- 194
                                          |:.||.|||                          
  Fly   773 EMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVK 837

Mouse   195 -------HNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSS 252
                   ||...|.:||....|.|||||||||||::.|||:|||..||.|..|:.:|:.|.||. 
  Fly   838 ARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVK- 901

Mouse   253 ATNEALGRLELWAPAKPGGPAKGL---APRPGDLVYMEDSPSFCRPSKYS---PGTAGRVCSRDS 311
             .|:. |||::          |.|   .|...||:|:::||.:||.| |:   |||.||||.::|
  Fly   902 -INKR-GRLQI----------KDLQFKVPTAHDLIYLDESPDWCRNS-YALHWPGTHGRVCHKNS 953

Mouse   312 ----SCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCK 358
                ||:.|||||||:|::.:|...|:|:..|||.|:|:.|.:....:|||
  Fly   954 SGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt9bNP_035849.3 wnt 62..358 CDD:278536 131/468 (28%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 131/468 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.