DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt11 and wntD

DIOPT Version :9

Sequence 1:NP_001272721.1 Gene:Wnt11 / 22411 MGIID:101948 Length:354 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:308 Identity:84/308 - (27%)
Similarity:125/308 - (40%) Gaps:76/308 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    76 AMKACRRAFADMRWNCSS----------IELAPNYLLDLERGTRESAFVYALSAATISHTIARAC 130
            |:.:|:::|...||||.|          .|.:||         ||..:|.|:|.|.|.||:.:.|
  Fly    47 ALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPN---------REDVYVAAISMAAIVHTLTKDC 102

Mouse   131 TSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKV-----KKTGSQANKLMR 190
            .:|.:.||                 ||.:|     .:....:..|.|.     |..||.:..:. 
  Fly   103 ANGVIAGC-----------------GCTEN-----ALNVPCAHEPTKALEQYEKHFGSGSGAIG- 144

Mouse   191 LHNSEVGRQALRASLETKCKCH---GVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPM 252
             ||..|....|:.|||.:|:|.   .|.|.|....|...|:..:.:|.||...|..|.::    .
  Fly   145 -HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL----E 204

Mouse   253 GTRKHL------VPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGS----D 307
            |...:|      :|.|         .||::|.||::|.::......||:.|||:|..:||    .
  Fly   205 GASSNLKIMWQNIPLD---------SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERL 260

Mouse   308 SCDLMC--CGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353
            ||..:|  ||........|...||:||..|...:.|..|.:...:|.|
  Fly   261 SCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt11NP_001272721.1 Wnt_Wnt11 51..354 CDD:381717 84/308 (27%)
wntDNP_650272.1 wnt 41..308 CDD:302926 83/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.