DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt11 and Wnt6

DIOPT Version :9

Sequence 1:NP_001272721.1 Gene:Wnt11 / 22411 MGIID:101948 Length:354 Species:Mus musculus
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:423 Identity:128/423 - (30%)
Similarity:192/423 - (45%) Gaps:103/423 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 VCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNLELMR-TIV 70
            |...|:||:.:     .|..|...:.    :.|:....||:...|.....::||.:..|:: .|:
  Fly     6 VIAILIFAMPM-----TGFGWAEGTN----ILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIII 61

Mouse    71 HAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDL 135
            :......:.|...|.:.||||:.:..:...:  |.|.:||:.||.|::||.:::.:.:|||.|.|
  Fly    62 NGINLGFRECEFQFRNRRWNCTVLRKSMRKI--LMRDSRETGFVNAITAAGVTYAVTKACTMGQL 124

Mouse   136 PGCSCG------------------------------------PVPGEPPG--------------- 149
            ..|||.                                    |:..:.|.               
  Fly   125 VECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDI 189

Mouse   150 ------------PGNR------------------WGGCADNLSYGLLMGAKFSDAPMKVKKTGSQ 184
                        ||.|                  ||||:||:::||.....|.||  |.::..|.
  Fly   190 APVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDA--KQRQRRSD 252

Mouse   185 ANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVH 249
            ...|::.||:..||.|:|.::..:|||||:||||:::|||..:...::||..|:.||.||.||..
  Fly   253 LGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL 317

Mouse   250 RPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCC 314
            |..|  ...:|:....||....:||:...|||||..|.|.|:.|||.|:||.||:|||.||.:||
  Fly   318 RNDG--NSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCC 380

Mouse   315 GRGYNPYTDRVVE---RCHCKYHWCCYVTCRRC 344
            .||   :|.|:||   .|.|.:.|||.|||.:|
  Fly   381 NRG---HTRRIVEEQTNCKCVFKWCCEVTCEKC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt11NP_001272721.1 Wnt_Wnt11 51..354 CDD:381717 119/379 (31%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 119/379 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.