DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10b and wntD

DIOPT Version :9

Sequence 1:NP_035848.1 Gene:Wnt10b / 22410 MGIID:108061 Length:389 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:335 Identity:83/335 - (24%)
Similarity:125/335 - (37%) Gaps:95/335 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    67 DVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRG-------FRESAFSFSML 124
            |:|.   :||..|:..||...:.|||||         |....:.|..       .||..:..::.
  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNC---------PSQDFVQKNSKPEENSPNREDVYVAAIS 90

Mouse   125 AAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSPVPGSVPSPG 189
            .|.::|.:...|:.|.:..|||      .::.|                          :||   
  Fly    91 MAAIVHTLTKDCANGVIAGCGC------TENAL--------------------------NVP--- 120

Mouse   190 PQDTWEWGGCNHDMDFG-EKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCH--- 250
                     |.|:.... |::.:.|.....|..        ||.||...::..:|:::|:|.   
  Fly   121 ---------CAHEPTKALEQYEKHFGSGSGAIG--------HNRRVVGALLQRSLEQECRCKQPG 168

Mouse   251 GTSGSCQFKTCWRAAPEFRAIGAALRERLSRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSP 315
            ...|.||.:.|......|.||...|.:....||.::..:.|.......:.    ...||:.:.||
  Fly   169 AVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQNIP----LDSLVFMQDSP 229

Mouse   316 DFCERDPTLGSPGTRGRACNKTSRLLDGCGS---------LCCGRGHNVLRQ-TRVE-RCHCRFH 369
            ::||||.|....|||||.|:|     ||.||         ||...|:.|..| .|.| ||:|:..
  Fly   230 NYCERDATGLWKGTRGRQCSK-----DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLV 289

Mouse   370 WCCYVLCDEC 379
            |...:.||.|
  Fly   290 WGFRLQCDVC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10bNP_035848.1 Wnt_Wnt10b 45..389 CDD:381730 83/335 (25%)
wntDNP_650272.1 wnt 41..308 CDD:302926 81/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.