DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10b and Wnt5

DIOPT Version :9

Sequence 1:NP_035848.1 Gene:Wnt10b / 22410 MGIID:108061 Length:389 Species:Mus musculus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:505 Identity:129/505 - (25%)
Similarity:178/505 - (35%) Gaps:211/505 - (41%)


- Green bases have known domain annotations that are detailed below.


Mouse    48 CLTLSGLSKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG---GRLPHHSAI 109
            |.:..|||..|...|::...|..:..:|...|:.|||.|.:::|||||.....   |.:...:| 
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAA- 611

Mouse   110 LKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFP 174
                 .|.||..::.||.|...:|.||..|:|.||.|                     |||    
  Fly   612 -----PEMAFIHALAAATVTSFIARACRDGQLASCSC---------------------SRG---- 646

Mouse   175 ISQPSPVPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREA-------------------- 219
             |:|..:         .|.|:||||..:::|..||:.||:||||.                    
  Fly   647 -SRPKQL---------HDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNR 701

Mouse   220 ----------------------------------------------------------------- 219
                                                                             
  Fly   702 MHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILT 766

Mouse   220 ------------------------------------------------PRD-------------- 222
                                                            ||:              
  Fly   767 SKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPR 831

Mouse   223 ----IQAR--MRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSR 281
                ::||  |.:|||..||:.|.:..:..|||||.||||...|||:.....|.||..|||:...
  Fly   832 STATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEG 896

Mouse   282 AIFIDTHNRNSGAFQPRLRPRRL------SGELVYFEKSPDFCERDPTLGSPGTRGRACNKTSRL 340
            |..:..:.|.      ||:.:.|      :.:|:|.::|||:|.....|..|||.||.|:|.|..
  Fly   897 ATKVKINKRG------RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSG 955

Mouse   341 LDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDEC-KVTEWVNVCK 389
            |:.|..||||||:|.......|||:|:|||||.|.|:.| ||.| .:.||
  Fly   956 LESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLE-EHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10bNP_035848.1 Wnt_Wnt10b 45..389 CDD:381730 127/503 (25%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 125/497 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.