DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10a and wntD

DIOPT Version :9

Sequence 1:NP_033544.1 Gene:Wnt10a / 22409 MGIID:108071 Length:417 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:336 Identity:84/336 - (25%)
Similarity:126/336 - (37%) Gaps:93/336 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    87 QGIQIAIHECQHQFRDQRWNCSSLE--TRNKVPYE-SPIFSRGFRESAFAYAIAAAGVVHAVSNA 148
            :|::.|:..||..|:.|||||.|.:  .:|..|.| ||     .||..:..||:.|.:||.::..
  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSP-----NREDVYVAAISMAAIVHTLTKD 101

Mouse   149 CALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPAILPASPGLQDSWEWGG 213
            ||.|.:..|||      .|.|...........||:                      |....:|.
  Fly   102 CANGVIAGCGC------TENALNVPCAHEPTKALE----------------------QYEKHFGS 138

Mouse   214 CSPDVGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCH---GTSGSCQLKT 275
            .|..:|                         ||.||....:..::.::|:|.   ...|.||.:.
  Fly   139 GSGAIG-------------------------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEE 178

Mouse   276 CWQVTPEFRTVGALLRNRFHRATLIRPHNRNGGQLEPGPAGAPSPAPGTPGLR---RRASHSDLV 337
            |..|...|..:...|...:..|.          |||    ||.|      .|:   :......||
  Fly   179 CVAVLKPFEAIAQDLLQMYDDAI----------QLE----GASS------NLKIMWQNIPLDSLV 223

Mouse   338 YFEKSPDFCEREPRLDSAGTVGRLCNKSSTGP----DGCGSMCCGRGHNILRQ-TRSE-RCHCRF 396
            :.:.||::|||:......||.||.|:|..:|.    ..|..:|...|:.:..| .|:| ||:|:.
  Fly   224 FMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKL 288

Mouse   397 HWCCFVVCEEC 407
            .|...:.|:.|
  Fly   289 VWGFRLQCDVC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10aNP_033544.1 wnt 67..417 CDD:278536 84/336 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..327 6/26 (23%)
wntDNP_650272.1 wnt 41..308 CDD:302926 84/336 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.