DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt1 and wntD

DIOPT Version :9

Sequence 1:NP_067254.1 Gene:Wnt1 / 22408 MGIID:98953 Length:370 Species:Mus musculus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:354 Identity:90/354 - (25%)
Similarity:134/354 - (37%) Gaps:91/354 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    50 SKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSG-GLQSAVRECKWQFRNRRWNCPTAPGPHLF 113
            :.:|..||||    :|..|.... |.|.....::| ||:.|:..|:..|:.:|||||:.......
  Fly    12 TSTLAAVLEP----MSYYQYTQF-QAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKN 71

Mouse   114 GK-IVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNI--- 174
            .| ..|...||..::.||:.|.:.|::.:.|:.|.|..|                 ||::|.   
  Fly    72 SKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGC-----------------GCTENALNV 119

Mouse   175 -----------DFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCH---GMSG 225
                       .:.:.||.   .||..|         ||.......:...:.|||:|.   .:.|
  Fly   120 PCAHEPTKALEQYEKHFGS---GSGAIG---------HNRRVVGALLQRSLEQECRCKQPGAVQG 172

Mouse   226 SCTVRTCWMRLPTLRAVGDVLRDRFD------GAS---RVLYGNRGSNRASRAELLRLEPEDPAH 281
            .|....|...|....|:...|...:|      |||   ::::.|              .|.|   
  Fly   173 ECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQN--------------IPLD--- 220

Mouse   282 KPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACN-SSSPALD---GCELLCCGRGHRTRTQRV- 341
                  .||:.:.|||:|.........||.||.|: ..|.:|:   .|:.||...|:|.|:|.| 
  Fly   221 ------SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVR 279

Mouse   342 TE-RCNCTFHWCCHVSCRNCTHTRVLHEC 369
            || ||||...|...:.|..|......:.|
  Fly   280 TERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt1NP_067254.1 WNT1 60..370 CDD:128408 85/344 (25%)
wntDNP_650272.1 wnt 41..308 CDD:302926 80/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.