DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and Wbp2

DIOPT Version :9

Sequence 1:NP_058548.1 Gene:Wbp2 / 22378 MGIID:104709 Length:261 Species:Mus musculus
Sequence 2:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster


Alignment Length:391 Identity:127/391 - (32%)
Similarity:157/391 - (40%) Gaps:141/391 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLS-KGK 64
            |::|..|: ..||:::..|.||:..|.|.:.|:...|  ..|||:|.|.:|||.:|:||.| |..
  Fly     1 MSVNTAHA-NNGVLIHAGEYILLHSDSVSMEFSGQDN--PIFKGSKGGRIYLTSHRMIFNSKKSS 62

Mouse    65 DAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQV 129
            |:||||..||..:.|.||:|||||||:|||.|:|:..|.:.|...:||.|.||||||:||.:|:.
  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127

Mouse   130 ASQASRGEVPNGAYG---YPYMPSGAYVFPPPVANGMYPCPPGY------------PYP------ 173
            |..|.......|..|   .||.|:|::...||.|   |..||||            |.|      
  Fly   128 AKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPA---YQPPPGYYGWLPQHDAFSGPAPNTVYMS 189

Mouse   174 --PPPPEFYPG-----------------------------PPMMD----------GAMGYVQPPP 197
              |||   |||                             ||...          .|.|||||||
  Fly   190 DNPPP---YPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPP 251

Mouse   198 -----------PPY-------------------------PGPMEP---PVSGPSAPATPAAEA-- 221
                       |||                         ||..:|   |...|..|..|..:|  
  Fly   252 YASCAPNCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAG 316

Mouse   222 ----------------------KAAEAAASAY---YNPGNPH---NVYMPTSQPPPPPYYPPEDK 258
                                  |.||||||||   ||.|.|.   |..:|.|....||.|....|
  Fly   317 AAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASK 381

Mouse   259 K 259
            |
  Fly   382 K 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_058548.1 PH-GRAM_WBP2 30..131 CDD:275401 51/101 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..261 34/133 (26%)
PPxY motif 1 196..200 3/14 (21%)
PPxY motif 2 248..252 1/3 (33%)
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 52/102 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833004
Domainoid 1 1.000 97 1.000 Domainoid score I7240
eggNOG 1 0.900 - - E1_KOG3294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4374
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 1 1.000 - - otm42778
orthoMCL 1 0.900 - - OOG6_103038
Panther 1 1.100 - - O PTHR31606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1809
SonicParanoid 1 1.000 - - X3867
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.