DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vrk1 and CkIalpha

DIOPT Version :9

Sequence 1:NP_001351296.1 Gene:Vrk1 / 22367 MGIID:1261847 Length:440 Species:Mus musculus
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:337 Identity:92/337 - (27%)
Similarity:153/337 - (45%) Gaps:51/337 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    43 IGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSD--NGPLFTELKFYQRAAKPEQIQKWIRTHKL 105
            ||.|.||.|||     ...:.|.....:|:|.:.  :..|..|.|.|:..:..            
  Fly    26 IGSGSFGDIYL-----GMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGG------------ 73

Mouse   106 KYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHE 170
              :|.|:.    .|....|::..::||..|..|:.::....:.|:.||||.|..:::..|||||.
  Fly    74 --VGFPRI----RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHL 132

Mouse   171 HEYVHGDIKASNLLLS---HKNPDQVYLVDYGLAYRYCPDGV--HKEYKEDPKRCHDGTLEFTSI 230
            ..::|.|||..|.|:.   |.|  :::|:|:|||.::.....  |..|:||...  .||..:.||
  Fly   133 KCFIHRDIKPDNFLMGIGRHCN--KLFLIDFGLAKKFRDPHTRHHIVYREDKNL--TGTARYASI 193

Mouse   231 DAHKGVAPSRRGDLEILGYCMIQWLSGCLPWED---NLKDPNYVRDSKIRYRDNVAALMEKCFPE 292
            :||.|:..|||.|:|.|||.|:.:..|.|||:.   |.|...|.:.|:.:....:..|   |   
  Fly   194 NAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL---C--- 252

Mouse   293 KNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVE--------NGSV 349
            |..|.|.:.|:...:.|.:.|:|.|..||.:.....:.:..:.|...|::.::        |.::
  Fly   253 KGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAI 317

Mouse   350 KTRPASKKRKKE 361
            ......|.::|:
  Fly   318 LLEQLDKDKEKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vrk1NP_001351296.1 STKc_VRK1 26..326 CDD:271024 87/292 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..440
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 87/290 (30%)
Pkinase_Tyr 23..284 CDD:285015 87/290 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.