DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and Vhl

DIOPT Version :9

Sequence 1:NP_033533.1 Gene:Vhl / 22346 MGIID:103223 Length:181 Species:Mus musculus
Sequence 2:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:65/167 - (38%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    33 NSREPSQ------------VIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLF 85
            |:|:..|            |:|.|.:.|.:...|:........|..|.|....|::::..|.|||
  Fly     8 NNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLF 72

Mouse    86 RDAGTHDGLLVNQTELFVP--------------SLNVDGQPIFANITLPVYTLKERCLQVV-RSL 135
            ||..|.:.:.|....:|.|              .::|..:.:   |..|:.:|:|.||.:| |.|
  Fly    73 RDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVL---IHFPMRSLRENCLWLVARWL 134

Mouse   136 VKPENYRRLDI------------VRSLYEDLEDYPSV 160
            ::..|..|..|            :.||...:|.|..|
  Fly   135 IRTSNAPRRIIHGYHIPSTLKQQLLSLLTCIESYSRV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_033533.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
VHL 27..171 CDD:280091 40/167 (24%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 123..132 4/8 (50%)
VhlNP_001260885.1 pVHL 21..162 CDD:176472 34/142 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4710
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107013
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.