DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vax1 and HGTX

DIOPT Version :10

Sequence 1:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:124 Identity:43/124 - (34%)
Similarity:65/124 - (52%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK------ 157
            :.|.||.:|:.:|::.||..|::.:|:.|.||.:||..|.:||:||||||||||||.:|      
  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEM 529

Mouse   158 --------DQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSA 208
                    |.|.|::  ...|||..:.:  ..|:.|.      .||....|.:.:.||:
  Fly   530 ATAKRKQDDMGGDND--GDCSETMDSDN--ESLDMGE------SPAQNKRCRSNSSGSS 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Homeodomain 101..157 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 29/57 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.