DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vax1 and btn

DIOPT Version :10

Sequence 1:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:165 Identity:48/165 - (29%)
Similarity:72/165 - (43%) Gaps:34/165 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 KNAHKESREIKGAEGSLPAAFLKEPQG--------AFSGSGASEDCNKSKSNSSADPDYCRRILV 79
            ||:|....:.......:..::|.:.:|        ..|.|.:..|.||.::|      :|     
  Fly     2 KNSHANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLETN------WC----- 55

Mouse    80 RDAKGSIREIILPKGLDL--DRPK--------RTRTSFTAEQLYRLEMEFQRCQYVVGRERTELA 134
            .:|.....:...|.|.:|  .|.|        :.||:|:..||.:||.||....|:....|.|:|
  Fly    56 NEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIA 120

Mouse   135 RQLNLSETQVKVWFQNRRTKQKK-----DQGKDSE 164
            ..|.|:|.||||||||||.|.|:     .||..::
  Fly   121 VALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 11/53 (21%)
Homeodomain 101..157 CDD:459649 28/63 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
btnNP_732768.1 Homeodomain 87..143 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.