DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vax1 and tin

DIOPT Version :10

Sequence 1:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:67/151 - (44%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 SEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILP--------KGLDLDRPKR-TRTSFTAEQL 112
            |::..|.|.||.          |..::..:|:..:.        .|....|.|| .|..|:..|:
  Fly   259 SDEGAKKKDNSQ----------VTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQV 313

Mouse   113 YRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCS 177
            ..||..|:..:|:.|.||..:|::||||.||||:||||||.|.|:.   |.:...:.....    
  Fly   314 LELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRG---DIDCEGIAKHLK---- 371

Mouse   178 VLRLLEQGRLLSPPGLPALLP 198
                |:...|.||..||..:|
  Fly   372 ----LKSEPLDSPTSLPPPIP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 5/11 (45%)
Homeodomain 101..157 CDD:459649 28/56 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
tinNP_524433.1 Homeodomain 302..358 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.