DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vax1 and lms

DIOPT Version :9

Sequence 1:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:292 Identity:87/292 - (29%)
Similarity:123/292 - (42%) Gaps:66/292 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    54 SGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILP--KGLDLDRPKRTRTSFTAEQLYRLE 116
            ||...:|..:...||.....|....:.|.|..| ::...  .||..||.||.||:|:|.|:..||
  Fly    39 SGRGGNCLGASRASSPATSSCLDDNMDDGKSDI-DLASDDGNGLGDDRKKRPRTAFSAAQIKALE 102

Mouse   117 MEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRL 181
            .||:|.:|:...:||.||:||.|:|||:|:||||||||.|:....|       .||.|:....:|
  Fly   103 TEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSD-------VETLASHYYAQL 160

Mouse   182 LEQGRLLSPPGLPALLPPCATG----ALGSALRGP----SLPALGAGAAAGSAAAAAAAAA---- 234
                      |:..|..|...|    .......||    |:...|:|:||..|:|..|..:    
  Fly   161 ----------GIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRP 215

Mouse   235 -ATA------PGPA-------GAASQHQPAVGGAP---GPGPAGPGGLHAGAPTASHGLFSLPVP 282
             ||:      |||:       ...::.||.....|   ...|||      |.|.||:      :|
  Fly   216 YATSGGMPPLPGPSVMESARNAILARGQPLNFALPFGVAKPPAG------GVPAASY------IP 268

Mouse   283 SLLGSVASRLSSAPLTMAGSLAGNLQELSARY 314
            .     ....:::.:..|.||..|...|..:|
  Fly   269 R-----CKPYATSYVDYAASLPTNESYLQMKY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 4/14 (29%)
Homeobox 103..156 CDD:306543 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 8/39 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 23/67 (34%)
Homeobox 89..142 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.