DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vars and GstT3

DIOPT Version :9

Sequence 1:NP_035820.3 Gene:Vars / 22321 MGIID:90675 Length:1263 Species:Mus musculus
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:147 Identity:33/147 - (22%)
Similarity:59/147 - (40%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   835 LGLKLTGKLPFREVYLHAIV--RDAHGRKMSKSLGNVIDPLDVIHGVSLQGLYDQLLNSNLDPSE 897
            :.|:||..:.||.|:|..::  |.....|:......:...|||:..|.|:| .|.|..|:|..::
  Fly   147 MSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEG-KDFLTGSSLTVAD 210

Mouse   898 VEKA---KEGQKADFPAGIPECGTDALRFGLCAYTSQGRDINLDVNRILGY----RHFCNKLWN- 954
            :..|   ::.:.||:                        |:.:...:|..:    |..||..:: 
  Fly   211 IFAACEIEQTRMADY------------------------DVRIKYPKIRAWLKRVRQSCNPYYDV 251

Mouse   955 ATKFALRGLGKGFVPSA 971
            |.:|..:..|.|  |.|
  Fly   252 AHEFVYKISGTG--PQA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VarsNP_035820.3 GST_C_family 92..213 CDD:383119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294
PTZ00419 281..1263 CDD:240411 33/147 (22%)
'HIGH' region 343..353
'KMSKS' region 861..865 1/3 (33%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 24/120 (20%)
GST_C_Theta 135..259 CDD:198292 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.