DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vars and GstT4

DIOPT Version :9

Sequence 1:NP_035820.3 Gene:Vars / 22321 MGIID:90675 Length:1263 Species:Mus musculus
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:96 Identity:28/96 - (29%)
Similarity:45/96 - (46%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse   135 LGKALNPLED-WLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQ- 197
            |...||..|. :|....::.||..:.|||:|:..:..|.....:....|  ..:.||:.| ||: 
  Fly   143 LEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNR--NKLARWYET-VREE 204

Mouse   198 --PEFRAVLGEV-ALYSGARSVTQQPGSEVI 225
              |.::.||||. |...|:.|..||..::.:
  Fly   205 LGPHYKEVLGEFEAKL
KGSGSGQQQGVAQAV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VarsNP_035820.3 GST_C_family 92..213 CDD:383119 24/82 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294 2/8 (25%)
PTZ00419 281..1263 CDD:240411
'HIGH' region 343..353
'KMSKS' region 861..865
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348
GST_C_Theta 95..220 CDD:198292 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.