DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vars and GstT2

DIOPT Version :9

Sequence 1:NP_035820.3 Gene:Vars / 22321 MGIID:90675 Length:1263 Species:Mus musculus
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:166 Identity:33/166 - (19%)
Similarity:64/166 - (38%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   769 EFGVSPDK---ISLQQDEDVLDTWFSSGLF---PFSIFGWPNQSEDLSV-------------FYP 814
            :|..||.:   |:|::.|.:.|.:.....|   |..:.|..:.||.:::             .||
  Fly    24 KFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYP 88

Mouse   815 GTL---------LETGHDILFFWVARMVMLGLKLTGKLPFREVYL---HAIVRDAHGRKMSKSLG 867
            .||         ||..|            |.::|...:.||:.:|   :.|.......::...:.
  Fly    89 KTLENRARVDEFLEWQH------------LNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIE 141

Mouse   868 NVIDPLDVIHGVSLQGLYDQLLNSNLDPSEVEKAKE 903
            .|.:.|.::..:.|:.  |.|:..||..:::..:.|
  Fly   142 GVENNLGLLERLWLEN--DFLVGKNLTMADILGSSE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VarsNP_035820.3 GST_C_family 92..213 CDD:383119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294
PTZ00419 281..1263 CDD:240411 33/166 (20%)
'HIGH' region 343..353
'KMSKS' region 861..865 0/3 (0%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/55 (22%)
GstA 7..202 CDD:223698 33/166 (20%)
GST_C_family 93..218 CDD:295467 17/97 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.