DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FDX1 and Fdx1

DIOPT Version :9

Sequence 1:NP_004100.1 Gene:FDX1 / 2230 HGNCID:3638 Length:184 Species:Homo sapiens
Sequence 2:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster


Alignment Length:108 Identity:40/108 - (37%)
Similarity:74/108 - (68%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    62 SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEK 126
            |:::.:.:.::::||:....:|||||::|.:...:.::::  ||||.:|||:|||:..:....:|
  Fly    52 STDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEME--GACEASLACTTCHVYVQHDYLQK 114

Human   127 LDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPE 169
            |....::|:|:||:|..|.:.|||||||.|.|||:.|.:.:|:
  Fly   115 LKEAEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELELPK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FDX1NP_004100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..57
fer2 67..168 CDD:320788 38/100 (38%)
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 39/103 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.