DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FERD3L and Fer2

DIOPT Version :9

Sequence 1:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:68 Identity:39/68 - (57%)
Similarity:50/68 - (73%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   102 QRQAANIRERKRM----------FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTEL 156
            ||||||:|||||:          .::|.|||:||..||||.||||||:|:||||||.|||.:.|:
  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212

Human   157 LES 159
            |::
  Fly   213 LQT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 38/64 (59%)
Fer2NP_001287359.1 HLH 148..210 CDD:278439 37/61 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.