Sequence 1: | NP_690862.1 | Gene: | FERD3L / 222894 | HGNCID: | 16660 | Length: | 166 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524322.1 | Gene: | Fer3 / 41411 | FlyBaseID: | FBgn0037937 | Length: | 195 | Species: | Drosophila melanogaster |
Alignment Length: | 76 | Identity: | 57/76 - (75%) |
---|---|---|---|
Similarity: | 63/76 - (82%) | Gaps: | 0/76 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 82 RGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLA 146
Human 147 IVYISFMTELL 157 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FERD3L | NP_690862.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 57..88 | 2/5 (40%) | |
bHLH_TS_FERD3L_NATO3 | 94..157 | CDD:381421 | 52/62 (84%) | ||
Fer3 | NP_524322.1 | HLH | 87..135 | CDD:278439 | 43/47 (91%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149605 | |
Domainoid | 1 | 1.000 | 94 | 1.000 | Domainoid score | I7499 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1513995at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0009159 | |
OrthoInspector | 1 | 1.000 | - | - | oto89607 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_109661 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR23349 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2562 |
SonicParanoid | 1 | 1.000 | - | - | X3328 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.780 |