DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FERD3L and Fer3

DIOPT Version :9

Sequence 1:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:76 Identity:57/76 - (75%)
Similarity:63/76 - (82%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    82 RGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLA 146
            |..|.|...:..|:||.:.|||:|||||||:||||||||||:|||||||||||||||||||||||
  Fly    67 RANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLA 131

Human   147 IVYISFMTELL 157
            |.||.||.|||
  Fly   132 ITYIGFMAELL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 2/5 (40%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 52/62 (84%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 43/47 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149605
Domainoid 1 1.000 94 1.000 Domainoid score I7499
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513995at2759
OrthoFinder 1 1.000 - - FOG0009159
OrthoInspector 1 1.000 - - oto89607
orthoMCL 1 0.900 - - OOG6_109661
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.