DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FERD3L and Hand

DIOPT Version :9

Sequence 1:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:83 Identity:28/83 - (33%)
Similarity:49/83 - (59%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    76 EEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRI 140
            |.:.:::....|.||...........:|..||.:||:|..::|.||..||.|:|....:.:||:|
  Fly    33 ESQVQQQIYNTSHLGYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKI 97

Human   141 ETLRLAIVYISFMTELLE 158
            :||:|||:||:::..:|:
  Fly    98 KTLKLAILYINYLVNVLD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 1/11 (9%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 23/62 (37%)
HandNP_609370.2 HLH 59..110 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.