DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FERD3L and HLH4C

DIOPT Version :9

Sequence 1:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:182 Identity:51/182 - (28%)
Similarity:72/182 - (39%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAYPESCVDTTVLDFVADLSLASPRRPLLC--DFAPGVSLG---------------------DP 42
            |||.|...:..:....|.|..:..|..|.|.  |:|...:|.                     .|
  Fly     8 MAAGPPQSISLSRYYLVDDDEMIGPNNPHLVNEDYAASTTLDIDKRFQARMACETAAQPAPPPPP 72

Human    43 ALALREGRPRRMARFEEGDPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAAN 107
            ..|.|    ||.......||.|..       |...||.            :|:|..|...|.|..
  Fly    73 TPAPR----RRTTPIAHLDPSELV-------GLSREER------------RRRRRATLKYRTAHA 114

Human   108 IRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLES 159
            .|||.|:...|.:|.:||:.:||...:|:||:||.|:|||.||:::..:||:
  Fly   115 TRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLET 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 6/30 (20%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 26/62 (42%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.