DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FERD3L and ase

DIOPT Version :9

Sequence 1:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens
Sequence 2:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster


Alignment Length:80 Identity:29/80 - (36%)
Similarity:42/80 - (52%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    90 GRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVP---TFAYE---------KRLSRIET 142
            |.|.||.:.........|.|||.|:..:|..|..||.|:|   :.|:|         |:||::||
  Fly   148 GTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVET 212

Human   143 LRLAIVYISFMTELL 157
            ||:|:.||..:.:||
  Fly   213 LRMAVEYIRSLEKLL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 25/74 (34%)
aseNP_476694.1 HLH <172..224 CDD:278439 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.