DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf2 and Usf

DIOPT Version :9

Sequence 1:NP_035810.1 Gene:Usf2 / 22282 MGIID:99961 Length:346 Species:Mus musculus
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:352 Identity:80/352 - (22%)
Similarity:128/352 - (36%) Gaps:132/352 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse   105 AAFAGGQQAVTQVGVDG-----------------------------AAQRPG------------- 127
            ::||.|||::......|                             ..|.||             
  Fly    60 SSFANGQQSLILTSDTGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNL 124

Mouse   128 --PAAASVPTGPAAPFPLAVIQNPFSNGGSPAAEA-------------------VSGEARFAYFP 171
              |....:|||    ..:.:::...|..|.|..:|                   .|...:.|...
  Fly   125 QLPNNLQLPTG----CEIYLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVIT 185

Mouse   172 ASSV--------GDTTAVSVQTTDQSLQAG--------GQFYVMMTPQDVLQTGTQRTIAPRTHP 220
            |.:|        ..||:.:..||..|:..|        |..:.        |..:|...|.:|. 
  Fly   186 AQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHA--------QARSQPESAGQTP- 241

Mouse   221 YSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSKTGA----------- 274
             |.|::..: .||::|||.|||||||||||||:||.:|.:::|...:.:|.:.|           
  Fly   242 -SSKLEAYK-KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTS 304

Mouse   275 ----------------------SKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQ 317
                                  ||..||.|||:||:.::.....:::..:|.:.|:..|:.||::
  Fly   305 TNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREE 369

Mouse   318 IEELKNENALLRAQLQQHNLEMVGEST 344
            ::.||.:.     |||:......|.||
  Fly   370 LDRLKRQQ-----QLQERFHTAGGRST 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usf2NP_035810.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..244 12/28 (43%)
bHLHzip_USF2 229..308 CDD:381493 34/111 (31%)
ZapB 290..>334 CDD:399182 9/43 (21%)
Leucine-zipper 307..328 6/20 (30%)
UsfNP_572167.3 HLH 255..343 CDD:278439 31/87 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11391
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 1 1.000 - - otm42982
orthoMCL 1 0.900 - - OOG6_108108
Panther 1 1.100 - - O PTHR46117
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.860

Return to query results.
Submit another query.