DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf1 and Mitf

DIOPT Version :9

Sequence 1:NP_001292605.1 Gene:Usf1 / 22278 MGIID:99542 Length:310 Species:Mus musculus
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:256 Identity:59/256 - (23%)
Similarity:105/256 - (41%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    85 PATQSMTQAVIQGAFTSDDAVDT------------EGAAAETHYTYFPSTAVGDGSGGTT---SG 134
            |:..:|..:...|:|...|.::.            .|.....|.|.....:..:.|..:|   ||
  Fly   363 PSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGEPENAHRTAQLGLSKANSSLSSTRSSSG 427

Mouse   135 STTAVVTTQGSEALLGQATP--PSTGQFFVMMSP-----QEVLQGGS-------QRSIAPRTHPY 185
            ...::..:..|.:|...:.|  ||.......:|.     .::||..|       ...::.:..|.
  Fly   428 IVNSIRISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQ 492

Mouse   186 S-PKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIP---DCSMESTKS-GQSKGGILS 245
            : ..:|.....:|.:::..||.:|||||..||:.|.:|..::|   |...|..:. ..:||.||.
  Fly   493 NLTDAEMNALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRPNKGTILK 557

Mouse   246 KACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLL-----LRAQLRHHGL 301
            .:.|||:.|:....||.:           |::.::||| |:|:.|:     |..|.:.||:
  Fly   558 SSVDYIKCLKHEVTRLRQ-----------NELRQRQVE-LQNRKLMSRIKELEMQAKSHGI 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usf1NP_001292605.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
UPF0492 <145..>284 CDD:374070 39/157 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..209 7/45 (16%)
bHLHzip_USF1 196..260 CDD:381494 23/67 (34%)
Leucine-zipper 271..292 7/25 (28%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573
HLH 505..570 CDD:238036 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.