DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upk1b and lbm

DIOPT Version :9

Sequence 1:NP_849255.2 Gene:Upk1b / 22268 MGIID:98912 Length:260 Species:Mus musculus
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:247 Identity:49/247 - (19%)
Similarity:87/247 - (35%) Gaps:74/247 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 IFGHVIVGMCG-IALTAECIFFVSDQHSLYPLLEATNNDDIFGAAWIGMFVGICLFCLSVLAIVG 79
            :.|.:..|..| ||..|:                 |..::...||:|.     |...| |.|::|
  Fly    18 VLGFLAAGAIGWIAYNAD-----------------TETEEFVIAAYIA-----CSLIL-VFALLG 59

Mouse    80 IMKSNRKILL-----AYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDD 139
            |..:.|:.::     |.|:::..:... |::|             |||.:..::   :.....:.
  Fly    60 IFAAIRESVVLTATSAVFLLILAILQI-VSTC-------------LFLHEFDVK---SGRDMVEV 107

Mouse   140 EWKNNGVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENNDADYPWPRQCCV-MDKLKEPLNLD 203
            .|:.|.:    |.|..:..|||.:...|:...:...           |..|.. :.:..:.|.||
  Fly   108 AWQANNM----DSLQQKHECCGQSSAQDYIHLSLLI-----------PPSCYADLQQTPDHLYLD 157

Mouse   204 ACKLGVPGYYHSQGCYELISGPMDRHAWGVAW--FGFAILCWTFWVLLGTMF 253
            .|...|..:|.|.....:|          |:|  ..|.::|:...|.|...|
  Fly   158 GCIEKVQSFYESDKLRFII----------VSWVLVAFELICFALAVFLAISF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Upk1bNP_849255.2 uroplakin_I_like_LEL 120..230 CDD:239409 21/110 (19%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 48/244 (20%)
tetraspanin_LEL <109..169 CDD:239401 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.