DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upk1b and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_849255.2 Gene:Upk1b / 22268 MGIID:98912 Length:260 Species:Mus musculus
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:243 Identity:53/243 - (21%)
Similarity:93/243 - (38%) Gaps:71/243 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    20 VIVGMCGIALTAECIFF---------VSDQHSLYPLLEATNNDDIFGAAWIGMFVGICLFCLSVL 75
            ||.|:|.:   ..|:..         :|::..   :|...:.:|:  ||.:.:.:|..:...|:.
  Fly    14 VISGICAL---GGCLLIWYGAWLLDSLSEEQR---MLGMDHGEDL--AAVLCVLLGTVIVVASIF 70

Mouse    76 AIVGIMKSNRKILLAYFIMM-FIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDD 139
            ..|.:.|.:|.:|:.|.::: |::....|...|:.|..|||...:  |:|.|           ||
  Fly    71 GSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDS--LRQGL-----------DD 122

Mouse   140 EW----KNNGVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENNDADYPWPRQCCVMDKLKEPL 200
            .|    :.|....|::..:   ||||.|...|:      ..:|...     |..||:.....:.|
  Fly   123 LWDLQHEGNSTLNTYEEWL---HCCGRNSAEDY------LHLEKMP-----PPSCCLNRDCTKHL 173

Mouse   201 NL--DACKLGVPGY-------YHSQGCYELISGPMDRHAWGVAWFGFA 239
            ||  ..|::....|       :||.             :|.:..|.||
  Fly   174 NLFMTGCEVKFKEYVGAKTANFHSL-------------SWFLVIFEFA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Upk1bNP_849255.2 uroplakin_I_like_LEL 120..230 CDD:239409 25/122 (20%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 53/243 (22%)
tetraspanin_LEL 109..192 CDD:239401 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.